Anti NDUFA5 pAb (ATL-HPA043175)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043175-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NDUFA5
Alternative Gene Name: B13, CI-13kB, CI-13KD-B, NUFM, UQOR13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023089: 82%, ENSRNOG00000005698: 78%
Entrez Gene ID: 4698
Uniprot ID: Q16718
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI |
| Gene Sequence | AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI |
| Gene ID - Mouse | ENSMUSG00000023089 |
| Gene ID - Rat | ENSRNOG00000005698 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFA5 pAb (ATL-HPA043175) | |
| Datasheet | Anti NDUFA5 pAb (ATL-HPA043175) Datasheet (External Link) |
| Vendor Page | Anti NDUFA5 pAb (ATL-HPA043175) at Atlas Antibodies |
| Documents & Links for Anti NDUFA5 pAb (ATL-HPA043175) | |
| Datasheet | Anti NDUFA5 pAb (ATL-HPA043175) Datasheet (External Link) |
| Vendor Page | Anti NDUFA5 pAb (ATL-HPA043175) |