Anti NDUFA5 pAb (ATL-HPA043175)

Atlas Antibodies

Catalog No.:
ATL-HPA043175-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5
Gene Name: NDUFA5
Alternative Gene Name: B13, CI-13kB, CI-13KD-B, NUFM, UQOR13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023089: 82%, ENSRNOG00000005698: 78%
Entrez Gene ID: 4698
Uniprot ID: Q16718
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Gene Sequence AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Gene ID - Mouse ENSMUSG00000023089
Gene ID - Rat ENSRNOG00000005698
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFA5 pAb (ATL-HPA043175)
Datasheet Anti NDUFA5 pAb (ATL-HPA043175) Datasheet (External Link)
Vendor Page Anti NDUFA5 pAb (ATL-HPA043175) at Atlas Antibodies

Documents & Links for Anti NDUFA5 pAb (ATL-HPA043175)
Datasheet Anti NDUFA5 pAb (ATL-HPA043175) Datasheet (External Link)
Vendor Page Anti NDUFA5 pAb (ATL-HPA043175)