Anti NDUFA12 pAb (ATL-HPA039903)

Atlas Antibodies

Catalog No.: ATL-HPA039903-25

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12
Gene Name: NDUFA12
Alternative Gene Name: B17.2, DAP13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020022: 87%, ENSRNOG00000007407: 86%
Entrez Gene ID: 55967
Uniprot ID: Q9UI09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
• Gene Sequence: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
• Gene ID - Mouse: ENSMUSG00000020022
• Gene ID - Rat: ENSRNOG00000007407
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NDUFA12 pAb (ATL-HPA039903) – 2 Found

Aass, Kristin Roseth; Mjelle, Robin; Kastnes, Martin H; Tryggestad, Synne S; van den Brink, Luca M; Aass Roseth, Ingrid; Westhrin, Marita; Zahoor, Muhammad; Moen, Siv H; Vikene Nedal, Tonje M; Buene, Glenn; Misund, Kristine; Sponaas, Anne-Marit; Ma, Qianli; Sundan, Anders; Groen, Richard Wj; Slørdahl, Tobias S; Waage, Anders; Standal, Therese. Intracellular IL-32 regulates mitochondrial metabolism, proliferation, and differentiation of malignant plasma cells. Iscience. 2022;25(1):103605. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.