Anti NCAPG pAb (ATL-HPA039613)

Atlas Antibodies

Catalog No.:
ATL-HPA039613-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: non-SMC condensin I complex, subunit G
Gene Name: NCAPG
Alternative Gene Name: CAP-G, FLJ12450, hCAP-G, YCG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015880: 84%, ENSRNOG00000038572: 79%
Entrez Gene ID: 64151
Uniprot ID: Q9BPX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLTPEIALYWCALCEYLKSKGDEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDT
Gene Sequence ETLTPEIALYWCALCEYLKSKGDEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDT
Gene ID - Mouse ENSMUSG00000015880
Gene ID - Rat ENSRNOG00000038572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCAPG pAb (ATL-HPA039613)
Datasheet Anti NCAPG pAb (ATL-HPA039613) Datasheet (External Link)
Vendor Page Anti NCAPG pAb (ATL-HPA039613) at Atlas Antibodies

Documents & Links for Anti NCAPG pAb (ATL-HPA039613)
Datasheet Anti NCAPG pAb (ATL-HPA039613) Datasheet (External Link)
Vendor Page Anti NCAPG pAb (ATL-HPA039613)