Anti NBR1 pAb (ATL-HPA022944)

Atlas Antibodies

Catalog No.:
ATL-HPA022944-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: neighbor of BRCA1 gene 1
Gene Name: NBR1
Alternative Gene Name: 1A1-3B, CA125, KIAA0049, M17S2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017119: 75%, ENSRNOG00000020730: 73%
Entrez Gene ID: 4077
Uniprot ID: Q14596
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR
Gene Sequence HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR
Gene ID - Mouse ENSMUSG00000017119
Gene ID - Rat ENSRNOG00000020730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NBR1 pAb (ATL-HPA022944)
Datasheet Anti NBR1 pAb (ATL-HPA022944) Datasheet (External Link)
Vendor Page Anti NBR1 pAb (ATL-HPA022944) at Atlas Antibodies

Documents & Links for Anti NBR1 pAb (ATL-HPA022944)
Datasheet Anti NBR1 pAb (ATL-HPA022944) Datasheet (External Link)
Vendor Page Anti NBR1 pAb (ATL-HPA022944)