Anti NBAS pAb (ATL-HPA036817)

Atlas Antibodies

Catalog No.: ATL-HPA036817-25

Protein Description: neuroblastoma amplified sequence
Gene Name: NBAS
Alternative Gene Name: NAG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020576: 83%, ENSRNOG00000024503: 83%
Entrez Gene ID: 51594
Uniprot ID: A2RRP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKGDLKFPLKIFQHSKPDLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPERGYGDKTEATTKLHDMVDQLEQILSVS
• Gene Sequence: AKGDLKFPLKIFQHSKPDLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPERGYGDKTEATTKLHDMVDQLEQILSVS
• Gene ID - Mouse: ENSMUSG00000020576
• Gene ID - Rat: ENSRNOG00000024503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NBAS pAb (ATL-HPA036817) – 2 Found

Xu, Dijin; Li, Yuqi; Wu, Lizhen; Li, Ying; Zhao, Dongyu; Yu, Jinhai; Huang, Tuozhi; Ferguson, Charles; Parton, Robert G; Yang, Hongyuan; Li, Peng. Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions. The Journal Of Cell Biology. 2018;217(3):975-995. 

Cousin, Margot A; Conboy, Erin; Wang, Jian-She; Lenz, Dominic; Schwab, Tanya L; Williams, Monique; Abraham, Roshini S; Barnett, Sarah; El-Youssef, Mounif; Graham, Rondell P; Gutierrez Sanchez, Luz Helena; Hasadsri, Linda; Hoffmann, Georg F; Hull, Nathan C; Kopajtich, Robert; Kovacs-Nagy, Reka; Li, Jia-Qi; Marx-Berger, Daniela; McLin, Valérie; McNiven, Mark A; Mounajjed, Taofic; Prokisch, Holger; Rymen, Daisy; Schulze, Ryan J; Staufner, Christian; Yang, Ye; Clark, Karl J; Lanpher, Brendan C; Klee, Eric W. RINT1 Bi-allelic Variations Cause Infantile-Onset Recurrent Acute Liver Failure and Skeletal Abnormalities. American Journal Of Human Genetics. 2019;105(1):108-121.