Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042041-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NEDD8 activating enzyme E1 subunit 1
Gene Name: NAE1
Alternative Gene Name: APPBP1, ula-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031878: 97%, ENSRNOG00000033133: 98%
Entrez Gene ID: 8883
Uniprot ID: Q13564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDR
Gene Sequence KPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDR
Gene ID - Mouse ENSMUSG00000031878
Gene ID - Rat ENSRNOG00000033133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation)
Datasheet Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation)
Datasheet Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation)
Citations for Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) – 1 Found
Zhang, Wenjuan; Liang, Yupei; Li, Lihui; Wang, Xiaofang; Yan, Zi; Dong, Changsheng; Zeng, Mu-Sheng; Zhong, Qian; Liu, Xue-Kui; Yu, Jinha; Sun, Shuyang; Liu, Xiaojun; Kang, Jihui; Zhao, Hu; Jeong, Lak Shin; Zhang, Yanmei; Jia, Lijun. The Nedd8-activating enzyme inhibitor MLN4924 (TAK-924/Pevonedistat) induces apoptosis via c-Myc-Noxa axis in head and neck squamous cell carcinoma. Cell Proliferation. 2019;52(2):e12536.  PubMed