Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042041-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NAE1
Alternative Gene Name: APPBP1, ula-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031878: 97%, ENSRNOG00000033133: 98%
Entrez Gene ID: 8883
Uniprot ID: Q13564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDR |
| Gene Sequence | KPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDR |
| Gene ID - Mouse | ENSMUSG00000031878 |
| Gene ID - Rat | ENSRNOG00000033133 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) | |
| Datasheet | Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) | |
| Datasheet | Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) |
| Citations for Anti NAE1 pAb (ATL-HPA042041 w/enhanced validation) – 1 Found |
| Zhang, Wenjuan; Liang, Yupei; Li, Lihui; Wang, Xiaofang; Yan, Zi; Dong, Changsheng; Zeng, Mu-Sheng; Zhong, Qian; Liu, Xue-Kui; Yu, Jinha; Sun, Shuyang; Liu, Xiaojun; Kang, Jihui; Zhao, Hu; Jeong, Lak Shin; Zhang, Yanmei; Jia, Lijun. The Nedd8-activating enzyme inhibitor MLN4924 (TAK-924/Pevonedistat) induces apoptosis via c-Myc-Noxa axis in head and neck squamous cell carcinoma. Cell Proliferation. 2019;52(2):e12536. PubMed |