Anti NAA11 pAb (ATL-HPA035922)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035922-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NAA11
Alternative Gene Name: ARD1B, ARD2, hARD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024571: 62%, ENSRNOG00000057774: 63%
Entrez Gene ID: 84779
Uniprot ID: Q9BSU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE |
| Gene Sequence | DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE |
| Gene ID - Mouse | ENSMUSG00000024571 |
| Gene ID - Rat | ENSRNOG00000057774 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAA11 pAb (ATL-HPA035922) | |
| Datasheet | Anti NAA11 pAb (ATL-HPA035922) Datasheet (External Link) |
| Vendor Page | Anti NAA11 pAb (ATL-HPA035922) at Atlas Antibodies |
| Documents & Links for Anti NAA11 pAb (ATL-HPA035922) | |
| Datasheet | Anti NAA11 pAb (ATL-HPA035922) Datasheet (External Link) |
| Vendor Page | Anti NAA11 pAb (ATL-HPA035922) |