Anti NAA11 pAb (ATL-HPA035922)

Atlas Antibodies

Catalog No.: ATL-HPA035922-25

Protein Description: N(alpha)-acetyltransferase 11, NatA catalytic subunit
Gene Name: NAA11
Alternative Gene Name: ARD1B, ARD2, hARD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024571: 62%, ENSRNOG00000057774: 63%
Entrez Gene ID: 84779
Uniprot ID: Q9BSU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE
• Gene Sequence: DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE
• Gene ID - Mouse: ENSMUSG00000024571
• Gene ID - Rat: ENSRNOG00000057774
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.