Anti MYRIP pAb (ATL-HPA006433)

Atlas Antibodies

Catalog No.: ATL-HPA006433-25

Protein Description: myosin VIIA and Rab interacting protein
Gene Name: MYRIP
Alternative Gene Name: DKFZp586F1018, exophilin-8, MyRIP, SLAC2-C, SLAC2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041794: 77%, ENSRNOG00000018797: 75%
Entrez Gene ID: 25924
Uniprot ID: Q8NFW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SALPSWKSVDRLDETNLAPVLQSPDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRNPQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSR
• Gene Sequence: SALPSWKSVDRLDETNLAPVLQSPDGNWVALKDGAPPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDSEEDFDWSEALSKLCPRSRALPRNPQPQPTQAQSSDQGPIAASPSSALSPNPEAMCSDSETSSAGSSR
• Gene ID - Mouse: ENSMUSG00000041794
• Gene ID - Rat: ENSRNOG00000018797
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.