Anti MYO9B pAb (ATL-HPA042043)

Atlas Antibodies

Catalog No.:
ATL-HPA042043-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: myosin IXB
Gene Name: MYO9B
Alternative Gene Name: CELIAC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004677: 59%, ENSRNOG00000016256: 62%
Entrez Gene ID: 4650
Uniprot ID: Q13459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDGERSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENAVSGHVVLEATTM
Gene Sequence TDGERSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENAVSGHVVLEATTM
Gene ID - Mouse ENSMUSG00000004677
Gene ID - Rat ENSRNOG00000016256
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYO9B pAb (ATL-HPA042043)
Datasheet Anti MYO9B pAb (ATL-HPA042043) Datasheet (External Link)
Vendor Page Anti MYO9B pAb (ATL-HPA042043) at Atlas Antibodies

Documents & Links for Anti MYO9B pAb (ATL-HPA042043)
Datasheet Anti MYO9B pAb (ATL-HPA042043) Datasheet (External Link)
Vendor Page Anti MYO9B pAb (ATL-HPA042043)