Anti MYO7B pAb (ATL-HPA039131 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039131-25

Protein Description: myosin VIIB
Gene Name: MYO7B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024388: 79%, ENSRNOG00000015035: 81%
Entrez Gene ID: 4648
Uniprot ID: Q6PIF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLVLTKKQGLLASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTEPRPEEPPKEKLHTL
• Gene Sequence: LLVLTKKQGLLASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTEPRPEEPPKEKLHTL
• Gene ID - Mouse: ENSMUSG00000024388
• Gene ID - Rat: ENSRNOG00000015035
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYO7B pAb (ATL-HPA039131 w/enhanced validation) – 5 Found

Weck, Meredith L; Crawley, Scott W; Stone, Colin R; Tyska, Matthew J. Myosin-7b Promotes Distal Tip Localization of the Intermicrovillar Adhesion Complex. Current Biology : Cb. 2016;26(20):2717-2728. 

Pinette, Julia A; Mao, Suli; Millis, Bryan A; Krystofiak, Evan S; Faust, James J; Tyska, Matthew J. Brush border protocadherin CDHR2 promotes the elongation and maximized packing of microvilli in vivo. Molecular Biology Of The Cell. 2019;30(1):108-118. 

Graves, Maura J; Matoo, Samaneh; Choi, Myoung Soo; Storad, Zachary A; El Sheikh Idris, Rawnag A; Pickles, Brooke K; Acharya, Prashun; Shinder, Paula E; Arvay, Taylen O; Crawley, Scott W. A cryptic sequence targets the adhesion complex scaffold ANKS4B to apical microvilli to promote enterocyte brush border assembly. The Journal Of Biological Chemistry. 2020;295(36):12588-12604. 

Matoo, Samaneh; Graves, Maura J; Acharya, Prashun; Choi, Myoung Soo; Storad, Zachary A; Idris, Rawnag A El Sheikh; Pickles, Brooke K; Arvay, Taylen O; Shinder, Paula E; Gerts, Andrew; Papish, Jacob P; Crawley, Scott W. Comparative analysis of the MyTH4-FERM myosins reveals insights into the determinants of actin track selection in polarized epithelia. Molecular Biology Of The Cell. 2021;32(21):ar30. 

Weck, Meredith L; Crawley, Scott W; Tyska, Matthew J. A heterologous in-cell assay for investigating intermicrovillar adhesion complex interactions reveals a novel protrusion length-matching mechanism. The Journal Of Biological Chemistry. 2020;295(48):16191-16206.