Anti MYL7 pAb (ATL-HPA013331 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA013331-25

Protein Description: myosin, light chain 7, regulatory
Gene Name: MYL7
Alternative Gene Name: MYL2A, MYLC2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020469: 94%, ENSRNOG00000014409: 93%
Entrez Gene ID: 58498
Uniprot ID: Q01449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEK
• Gene Sequence: DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEK
• Gene ID - Mouse: ENSMUSG00000020469
• Gene ID - Rat: ENSRNOG00000014409
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.