Anti MYH15 pAb (ATL-HPA034871)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034871-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MYH15
Alternative Gene Name: KIAA1000
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092009: 77%, ENSRNOG00000061038: 73%
Entrez Gene ID: 22989
Uniprot ID: Q9Y2K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETTSASLKKRH |
| Gene Sequence | KMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETTSASLKKRH |
| Gene ID - Mouse | ENSMUSG00000092009 |
| Gene ID - Rat | ENSRNOG00000061038 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYH15 pAb (ATL-HPA034871) | |
| Datasheet | Anti MYH15 pAb (ATL-HPA034871) Datasheet (External Link) |
| Vendor Page | Anti MYH15 pAb (ATL-HPA034871) at Atlas Antibodies |
| Documents & Links for Anti MYH15 pAb (ATL-HPA034871) | |
| Datasheet | Anti MYH15 pAb (ATL-HPA034871) Datasheet (External Link) |
| Vendor Page | Anti MYH15 pAb (ATL-HPA034871) |