Anti MYCBPAP pAb (ATL-HPA023257 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023257-25

Protein Description: MYCBP associated protein
Gene Name: MYCBPAP
Alternative Gene Name: AMAP-1, DKFZp434N1415
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039110: 48%, ENSRNOG00000042912: 52%
Entrez Gene ID: 84073
Uniprot ID: Q8TBZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLPRFRSPISETQVPRPENEALRESGSQKARVGTKSPQRKSIMEEILVEESPDVDSTKSPWEPDGLPLLEWNLCLEDFRKAVMVLPDENHREDALMRLNKAALELCQKPRPLQSNLLHQM
• Gene Sequence: LLPRFRSPISETQVPRPENEALRESGSQKARVGTKSPQRKSIMEEILVEESPDVDSTKSPWEPDGLPLLEWNLCLEDFRKAVMVLPDENHREDALMRLNKAALELCQKPRPLQSNLLHQM
• Gene ID - Mouse: ENSMUSG00000039110
• Gene ID - Rat: ENSRNOG00000042912
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.