Anti MYCBP pAb (ATL-HPA041188)

Atlas Antibodies

Catalog No.: ATL-HPA041188-25

Protein Description: MYC binding protein
Gene Name: MYCBP
Alternative Gene Name: AMY-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028647: 96%, ENSRNOG00000017166: 96%
Entrez Gene ID: 26292
Uniprot ID: Q99417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEE
• Gene Sequence: LVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEE
• Gene ID - Mouse: ENSMUSG00000028647
• Gene ID - Rat: ENSRNOG00000017166
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYCBP pAb (ATL-HPA041188) – 1 Found

Nakamura, Mayumi; Hayashi, Masami; Konishi, Hiromi; Nunode, Misa; Ashihara, Keisuke; Sasaki, Hiroshi; Terai, Yoshito; Ohmichi, Masahide. MicroRNA-22 enhances radiosensitivity in cervical cancer cell lines via direct inhibition of c-Myc binding protein, and the subsequent reduction in hTERT expression. Oncology Letters. 2020;19(3):2213-2222.