Anti MXI1 pAb (ATL-HPA035319)

Atlas Antibodies

Catalog No.: ATL-HPA035319-25

Protein Description: MAX interactor 1, dimerization protein
Gene Name: MXI1
Alternative Gene Name: bHLHc11, MAD2, MXD2, MXI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025025: 98%, ENSRNOG00000034078: 98%
Entrez Gene ID: 4601
Uniprot ID: P50539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
• Gene Sequence: HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
• Gene ID - Mouse: ENSMUSG00000025025
• Gene ID - Rat: ENSRNOG00000034078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MXI1 pAb (ATL-HPA035319) – 2 Found

Huang, Yumei; Hu, Kaishun; Zhang, Sheng; Dong, Xiaorong; Yin, Zhongyuan; Meng, Rui; Zhao, Yingchao; Dai, Xiaofang; Zhang, Tao; Yang, Kunyu; Liu, Li; Huang, Kai; Shi, Shaojun; Zhang, Yu; Chen, Junjie; Wu, Gang; Xu, Shuangbing. S6K1 phosphorylation-dependent degradation of Mxi1 by β-Trcp ubiquitin ligase promotes Myc activation and radioresistance in lung cancer. Theranostics. 8(5):1286-1300. 

Huang, Yumei; Yang, Xijie; Lu, Yanwei; Zhao, Ye; Meng, Rui; Zhang, Sheng; Dong, Xiaorong; Xu, Shuangbing; Wu, Gang. UBE2O targets Mxi1 for ubiquitination and degradation to promote lung cancer progression and radioresistance. Cell Death And Differentiation. 2021;28(2):671-684.