Anti MVB12A pAb (ATL-HPA041885)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041885-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MVB12A
Alternative Gene Name: FAM125A, FLJ32495
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031813: 77%, ENSRNOG00000017949: 73%
Entrez Gene ID: 93343
Uniprot ID: Q96EY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL |
| Gene Sequence | LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL |
| Gene ID - Mouse | ENSMUSG00000031813 |
| Gene ID - Rat | ENSRNOG00000017949 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MVB12A pAb (ATL-HPA041885) | |
| Datasheet | Anti MVB12A pAb (ATL-HPA041885) Datasheet (External Link) |
| Vendor Page | Anti MVB12A pAb (ATL-HPA041885) at Atlas Antibodies |
| Documents & Links for Anti MVB12A pAb (ATL-HPA041885) | |
| Datasheet | Anti MVB12A pAb (ATL-HPA041885) Datasheet (External Link) |
| Vendor Page | Anti MVB12A pAb (ATL-HPA041885) |