Anti MUC5AC pAb (ATL-HPA040615 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040615-25

Protein Description: mucin 5AC, oligomeric mucus/gel-forming
Gene Name: MUC5AC
Alternative Gene Name: MUC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037974: 75%, ENSRNOG00000055996: 79%
Entrez Gene ID: 4586
Uniprot ID: P98088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG
• Gene Sequence: LDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQEVPCPG
• Gene ID - Mouse: ENSMUSG00000037974
• Gene ID - Rat: ENSRNOG00000055996
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MUC5AC pAb (ATL-HPA040615 w/enhanced validation) – 1 Found

Bandeira, Francisco; Yam, Gary Hin-Fai; Fuest, Matthias; Ong, Hon Shing; Liu, Yu-Chi; Seah, Xin-Yi; Shen, Sunny Y; Mehta, Jodhbir S. Urea-De-Epithelialized Human Amniotic Membrane for Ocular Surface Reconstruction. Stem Cells Translational Medicine. 2019;8(7):620-626.