Anti MTX2 pAb (ATL-HPA031552)

Atlas Antibodies

Catalog No.:
ATL-HPA031552-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: metaxin 2
Gene Name: MTX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027099: 97%, ENSRNOG00000001559: 95%
Entrez Gene ID: 10651
Uniprot ID: O75431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAK
Gene Sequence TLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAK
Gene ID - Mouse ENSMUSG00000027099
Gene ID - Rat ENSRNOG00000001559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTX2 pAb (ATL-HPA031552)
Datasheet Anti MTX2 pAb (ATL-HPA031552) Datasheet (External Link)
Vendor Page Anti MTX2 pAb (ATL-HPA031552) at Atlas Antibodies

Documents & Links for Anti MTX2 pAb (ATL-HPA031552)
Datasheet Anti MTX2 pAb (ATL-HPA031552) Datasheet (External Link)
Vendor Page Anti MTX2 pAb (ATL-HPA031552)