Anti MTRR pAb (ATL-HPA038113)

Atlas Antibodies

Catalog No.:
ATL-HPA038113-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
Gene Name: MTRR
Alternative Gene Name: cblE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034617: 60%, ENSRNOG00000017826: 59%
Entrez Gene ID: 4552
Uniprot ID: Q9UBK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASLRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN
Gene Sequence GLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASLRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN
Gene ID - Mouse ENSMUSG00000034617
Gene ID - Rat ENSRNOG00000017826
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTRR pAb (ATL-HPA038113)
Datasheet Anti MTRR pAb (ATL-HPA038113) Datasheet (External Link)
Vendor Page Anti MTRR pAb (ATL-HPA038113) at Atlas Antibodies

Documents & Links for Anti MTRR pAb (ATL-HPA038113)
Datasheet Anti MTRR pAb (ATL-HPA038113) Datasheet (External Link)
Vendor Page Anti MTRR pAb (ATL-HPA038113)