Anti MTRR pAb (ATL-HPA038113)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038113-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MTRR
Alternative Gene Name: cblE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034617: 60%, ENSRNOG00000017826: 59%
Entrez Gene ID: 4552
Uniprot ID: Q9UBK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASLRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN |
| Gene Sequence | GLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASLRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN |
| Gene ID - Mouse | ENSMUSG00000034617 |
| Gene ID - Rat | ENSRNOG00000017826 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MTRR pAb (ATL-HPA038113) | |
| Datasheet | Anti MTRR pAb (ATL-HPA038113) Datasheet (External Link) |
| Vendor Page | Anti MTRR pAb (ATL-HPA038113) at Atlas Antibodies |
| Documents & Links for Anti MTRR pAb (ATL-HPA038113) | |
| Datasheet | Anti MTRR pAb (ATL-HPA038113) Datasheet (External Link) |
| Vendor Page | Anti MTRR pAb (ATL-HPA038113) |