Anti MTPAP pAb (ATL-HPA038620)

Atlas Antibodies

Catalog No.:
ATL-HPA038620-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial poly(A) polymerase
Gene Name: MTPAP
Alternative Gene Name: FLJ10486, mtPAP, PAPD1, SPAX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024234: 85%, ENSRNOG00000016578: 86%
Entrez Gene ID: 55149
Uniprot ID: Q9NVV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS
Gene Sequence ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS
Gene ID - Mouse ENSMUSG00000024234
Gene ID - Rat ENSRNOG00000016578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTPAP pAb (ATL-HPA038620)
Datasheet Anti MTPAP pAb (ATL-HPA038620) Datasheet (External Link)
Vendor Page Anti MTPAP pAb (ATL-HPA038620) at Atlas Antibodies

Documents & Links for Anti MTPAP pAb (ATL-HPA038620)
Datasheet Anti MTPAP pAb (ATL-HPA038620) Datasheet (External Link)
Vendor Page Anti MTPAP pAb (ATL-HPA038620)