Anti MTIF3 pAb (ATL-HPA039791)

Atlas Antibodies

Catalog No.: ATL-HPA039791-25

Protein Description: mitochondrial translational initiation factor 3
Gene Name: MTIF3
Alternative Gene Name: IF-3mt, IF3(mt)
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016510: 66%, ENSRNOG00000047329: 61%
Entrez Gene ID: 219402
Uniprot ID: Q9H2K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
• Gene Sequence: KHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
• Gene ID - Mouse: ENSMUSG00000016510
• Gene ID - Rat: ENSRNOG00000047329
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MTIF3 pAb (ATL-HPA039791) – 1 Found

Lee, Soyeon; Park, Dongkeun; Lim, Chunghun; Kim, Jae-Ick; Min, Kyung-Tai. mtIF3 is locally translated in axons and regulates mitochondrial translation for axonal growth. Bmc Biology. 2022;20(1):12.