Anti MTHFSD pAb (ATL-HPA041333)

Atlas Antibodies

Catalog No.: ATL-HPA041333-25

Protein Description: methenyltetrahydrofolate synthetase domain containing
Gene Name: MTHFSD
Alternative Gene Name: FLJ12998
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031816: 86%, ENSRNOG00000046443: 63%
Entrez Gene ID: 64779
Uniprot ID: Q2M296
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARTQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITP
• Gene Sequence: VSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARTQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITP
• Gene ID - Mouse: ENSMUSG00000031816
• Gene ID - Rat: ENSRNOG00000046443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.