Anti MTHFD1 pAb (ATL-HPA001290 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001290-25

Protein Description: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
Gene Name: MTHFD1
Alternative Gene Name: MTHFC, MTHFD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021048: 90%, ENSRNOG00000005602: 90%
Entrez Gene ID: 4522
Uniprot ID: P11586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPGKWMIQYNNLNLKTPVPSDIDISRSCKPKPIGKLAREIGLLSEEVELYGETKAKVLLSALEGAPHR
• Gene Sequence: ILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPGKWMIQYNNLNLKTPVPSDIDISRSCKPKPIGKLAREIGLLSEEVELYGETKAKVLLSALEGAPHR
• Gene ID - Mouse: ENSMUSG00000021048
• Gene ID - Rat: ENSRNOG00000005602
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MTHFD1 pAb (ATL-HPA001290 w/enhanced validation) – 2 Found

Germain, Marie-Anne; Chatel-Chaix, Laurent; Gagné, Bridget; Bonneil, Éric; Thibault, Pierre; Pradezynski, Fabrine; de Chassey, Benoît; Meyniel-Schicklin, Laurène; Lotteau, Vincent; Baril, Martin; Lamarre, Daniel. Elucidating novel hepatitis C virus-host interactions using combined mass spectrometry and functional genomics approaches. Molecular & Cellular Proteomics : Mcp. 2014;13(1):184-203. 

Yao, Sha; Peng, Luogen; Elakad, Omar; Küffer, Stefan; Hinterthaner, Marc; Danner, Bernhard C; von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. One carbon metabolism in human lung cancer. Translational Lung Cancer Research. 2021;10(6):2523-2538.