Anti MTCP1 pAb (ATL-HPA032040)

Atlas Antibodies

Catalog No.: ATL-HPA032040-25

Protein Description: mature T-cell proliferation 1
Gene Name: MTCP1
Alternative Gene Name: P13MTCP1, p8MTCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031200: 94%, ENSRNOG00000024071: 63%
Entrez Gene ID: 4515
Uniprot ID: P56278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELL
• Gene Sequence: DHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELL
• Gene ID - Mouse: ENSMUSG00000031200
• Gene ID - Rat: ENSRNOG00000024071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.