Anti MSTO1 pAb (ATL-HPA005914)

Atlas Antibodies

Catalog No.:
ATL-HPA005914-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: misato 1, mitochondrial distribution and morphology regulator
Gene Name: MSTO1
Alternative Gene Name: FLJ10504, LST005, misato, MST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068922: 73%, ENSRNOG00000020357: 70%
Entrez Gene ID: 55154
Uniprot ID: Q9BUK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD
Gene Sequence DRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD
Gene ID - Mouse ENSMUSG00000068922
Gene ID - Rat ENSRNOG00000020357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSTO1 pAb (ATL-HPA005914)
Datasheet Anti MSTO1 pAb (ATL-HPA005914) Datasheet (External Link)
Vendor Page Anti MSTO1 pAb (ATL-HPA005914) at Atlas Antibodies

Documents & Links for Anti MSTO1 pAb (ATL-HPA005914)
Datasheet Anti MSTO1 pAb (ATL-HPA005914) Datasheet (External Link)
Vendor Page Anti MSTO1 pAb (ATL-HPA005914)