Anti MST1R pAb (ATL-HPA008180 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008180-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MST1R
Alternative Gene Name: CD136, CDw136, PTK8, RON
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032584: 74%, ENSRNOG00000032618: 69%
Entrez Gene ID: 4486
Uniprot ID: Q04912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP |
| Gene Sequence | EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP |
| Gene ID - Mouse | ENSMUSG00000032584 |
| Gene ID - Rat | ENSRNOG00000032618 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MST1R pAb (ATL-HPA008180 w/enhanced validation) | |
| Datasheet | Anti MST1R pAb (ATL-HPA008180 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MST1R pAb (ATL-HPA008180 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MST1R pAb (ATL-HPA008180 w/enhanced validation) | |
| Datasheet | Anti MST1R pAb (ATL-HPA008180 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MST1R pAb (ATL-HPA008180 w/enhanced validation) |
| Citations for Anti MST1R pAb (ATL-HPA008180 w/enhanced validation) – 2 Found |
| Ding, Ren-Bo; Chen, Ping; Rajendran, Barani Kumar; Lyu, Xueying; Wang, Haitao; Bao, Jiaolin; Zeng, Jianming; Hao, Wenhui; Sun, Heng; Wong, Ada Hang-Heng; Valecha, Monica Vishnu; Yang, Eun Ju; Su, Sek Man; Choi, Tak Kan; Liu, Shuiming; Chan, Kin Iong; Yang, Ling-Lin; Wu, Jingbo; Miao, Kai; Chen, Qiang; Shim, Joong Sup; Xu, Xiaoling; Deng, Chu-Xia. Molecular landscape and subtype-specific therapeutic response of nasopharyngeal carcinoma revealed by integrative pharmacogenomics. Nature Communications. 2021;12(1):3046. PubMed |
| Berning, Philipp; Hennemann, Carolin; Tulotta, Claudia; Schaefer, Christiane; Lechtape, Birgit; Hotfilder, Marc; El Gourari, Yassmine; Jürgens, Heribert; Snaar-Jagalska, Ewa; Hempel, Georg; Dirksen, Uta; Potratz, Jenny. The Receptor Tyrosine Kinase RON and Its Isoforms as Therapeutic Targets in Ewing Sarcoma. Cancers. 2020;12(4) PubMed |