Anti MSANTD2 pAb (ATL-HPA038695)

Atlas Antibodies

Catalog No.:
ATL-HPA038695-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Myb/SANT-like DNA-binding domain containing 2
Gene Name: MSANTD2
Alternative Gene Name: C11orf61, FLJ23342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042138: 100%, ENSRNOG00000009950: 100%
Entrez Gene ID: 79684
Uniprot ID: Q6P1R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETNALIAVWGNERLVEARYQQLEGAGTVFGSKAPGPAMYERVSRALAELGYERTPSQCRERIKTLRRCYSRVKEHGVGKRKSSYTFEQLEQVFGQ
Gene Sequence ETNALIAVWGNERLVEARYQQLEGAGTVFGSKAPGPAMYERVSRALAELGYERTPSQCRERIKTLRRCYSRVKEHGVGKRKSSYTFEQLEQVFGQ
Gene ID - Mouse ENSMUSG00000042138
Gene ID - Rat ENSRNOG00000009950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSANTD2 pAb (ATL-HPA038695)
Datasheet Anti MSANTD2 pAb (ATL-HPA038695) Datasheet (External Link)
Vendor Page Anti MSANTD2 pAb (ATL-HPA038695) at Atlas Antibodies

Documents & Links for Anti MSANTD2 pAb (ATL-HPA038695)
Datasheet Anti MSANTD2 pAb (ATL-HPA038695) Datasheet (External Link)
Vendor Page Anti MSANTD2 pAb (ATL-HPA038695)