Anti MRPS34 pAb (ATL-HPA042112 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042112-25

Protein Description: mitochondrial ribosomal protein S34
Gene Name: MRPS34
Alternative Gene Name: MGC2616, MRP-S12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038880: 82%, ENSRNOG00000015479: 80%
Entrez Gene ID: 65993
Uniprot ID: P82930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT
• Gene Sequence: PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT
• Gene ID - Mouse: ENSMUSG00000038880
• Gene ID - Rat: ENSRNOG00000015479
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MRPS34 pAb (ATL-HPA042112 w/enhanced validation) – 4 Found

Richman, Tara R; Spåhr, Henrik; Ermer, Judith A; Davies, Stefan M K; Viola, Helena M; Bates, Kristyn A; Papadimitriou, John; Hool, Livia C; Rodger, Jennifer; Larsson, Nils-Göran; Rackham, Oliver; Filipovska, Aleksandra. Loss of the RNA-binding protein TACO1 causes late-onset mitochondrial dysfunction in mice. Nature Communications. 2016;7( 27319982):11884. 

Perks, Kara L; Ferreira, Nicola; Richman, Tara R; Ermer, Judith A; Kuznetsova, Irina; Shearwood, Anne-Marie J; Lee, Richard G; Viola, Helena M; Johnstone, Victoria P A; Matthews, Vance; Hool, Livia C; Rackham, Oliver; Filipovska, Aleksandra. Adult-onset obesity is triggered by impaired mitochondrial gene expression. Science Advances. 2017;3(8):e1700677. 

Rudler, Danielle L; Hughes, Laetitia A; Perks, Kara L; Richman, Tara R; Kuznetsova, Irina; Ermer, Judith A; Abudulai, Laila N; Shearwood, Anne-Marie J; Viola, Helena M; Hool, Livia C; Siira, Stefan J; Rackham, Oliver; Filipovska, Aleksandra. Fidelity of translation initiation is required for coordinated respiratory complex assembly. Science Advances. 2019;5(12):eaay2118. 

Guo, Zhengguang; Shao, Chen; Zhang, Yang; Qiu, Wenying; Li, Wenting; Zhu, Weimin; Yang, Qian; Huang, Yin; Pan, Lili; Dong, Yuepan; Sun, Haidan; Xiao, Xiaoping; Sun, Wei; Ma, Chao; Zhang, Liwei. A Global Multiregional Proteomic Map of the Human Cerebral Cortex. Genomics, Proteomics & Bioinformatics. 2022;20(4):614-632.