Anti MRPS33 pAb (ATL-HPA030425)

Atlas Antibodies

Catalog No.:
ATL-HPA030425-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S33
Gene Name: MRPS33
Alternative Gene Name: CGI-139
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029918: 82%, ENSRNOG00000026528: 83%
Entrez Gene ID: 51650
Uniprot ID: Q9Y291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR
Gene Sequence MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR
Gene ID - Mouse ENSMUSG00000029918
Gene ID - Rat ENSRNOG00000026528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS33 pAb (ATL-HPA030425)
Datasheet Anti MRPS33 pAb (ATL-HPA030425) Datasheet (External Link)
Vendor Page Anti MRPS33 pAb (ATL-HPA030425) at Atlas Antibodies

Documents & Links for Anti MRPS33 pAb (ATL-HPA030425)
Datasheet Anti MRPS33 pAb (ATL-HPA030425) Datasheet (External Link)
Vendor Page Anti MRPS33 pAb (ATL-HPA030425)