Anti MRPS25 pAb (ATL-HPA043490)

Atlas Antibodies

Catalog No.: ATL-HPA043490-100

Protein Description: mitochondrial ribosomal protein S25
Gene Name: MRPS25
Alternative Gene Name: DKFZp313H0817, FLJ00023, MRP-S25, RPMS25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014551: 80%, ENSRNOG00000010912: 80%
Entrez Gene ID: 64432
Uniprot ID: P82663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
• Gene Sequence: LREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
• Gene ID - Mouse: ENSMUSG00000014551
• Gene ID - Rat: ENSRNOG00000010912
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.