Anti MRPS15 pAb (ATL-HPA028134)

Atlas Antibodies

Catalog No.: ATL-HPA028134-25

Protein Description: mitochondrial ribosomal protein S15
Gene Name: MRPS15
Alternative Gene Name: FLJ11564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028861: 55%, ENSRNOG00000008279: 58%
Entrez Gene ID: 64960
Uniprot ID: P82914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKE
• Gene Sequence: AKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKE
• Gene ID - Mouse: ENSMUSG00000028861
• Gene ID - Rat: ENSRNOG00000008279
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MRPS15 pAb (ATL-HPA028134) – 1 Found

Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401.