Anti MRPL54 pAb (ATL-HPA042117)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042117-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MRPL54
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034932: 49%, ENSRNOG00000020464: 54%
Entrez Gene ID: 116541
Uniprot ID: Q6P161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVC |
| Gene Sequence | ATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVC |
| Gene ID - Mouse | ENSMUSG00000034932 |
| Gene ID - Rat | ENSRNOG00000020464 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPL54 pAb (ATL-HPA042117) | |
| Datasheet | Anti MRPL54 pAb (ATL-HPA042117) Datasheet (External Link) |
| Vendor Page | Anti MRPL54 pAb (ATL-HPA042117) at Atlas Antibodies |
| Documents & Links for Anti MRPL54 pAb (ATL-HPA042117) | |
| Datasheet | Anti MRPL54 pAb (ATL-HPA042117) Datasheet (External Link) |
| Vendor Page | Anti MRPL54 pAb (ATL-HPA042117) |