Anti MRPL54 pAb (ATL-HPA042117)

Atlas Antibodies

Catalog No.:
ATL-HPA042117-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L54
Gene Name: MRPL54
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034932: 49%, ENSRNOG00000020464: 54%
Entrez Gene ID: 116541
Uniprot ID: Q6P161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVC
Gene Sequence ATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVC
Gene ID - Mouse ENSMUSG00000034932
Gene ID - Rat ENSRNOG00000020464
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL54 pAb (ATL-HPA042117)
Datasheet Anti MRPL54 pAb (ATL-HPA042117) Datasheet (External Link)
Vendor Page Anti MRPL54 pAb (ATL-HPA042117) at Atlas Antibodies

Documents & Links for Anti MRPL54 pAb (ATL-HPA042117)
Datasheet Anti MRPL54 pAb (ATL-HPA042117) Datasheet (External Link)
Vendor Page Anti MRPL54 pAb (ATL-HPA042117)