Anti MRPL44 pAb (ATL-HPA038148)

Atlas Antibodies

Catalog No.: ATL-HPA038148-25

Protein Description: mitochondrial ribosomal protein L44
Gene Name: MRPL44
Alternative Gene Name: FLJ12701, FLJ13990
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026248: 85%, ENSRNOG00000015231: 87%
Entrez Gene ID: 65080
Uniprot ID: Q9H9J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQ
• Gene Sequence: SGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQ
• Gene ID - Mouse: ENSMUSG00000026248
• Gene ID - Rat: ENSRNOG00000015231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.