Anti MRPL41 pAb (ATL-HPA027160)

Atlas Antibodies

Catalog No.:
ATL-HPA027160-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L41
Gene Name: MRPL41
Alternative Gene Name: BMRP, MRP-L27, MRPL27, PIG3, RPML27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036850: 79%, ENSRNOG00000029875: 79%
Entrez Gene ID: 64975
Uniprot ID: Q8IXM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL
Gene Sequence GADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL
Gene ID - Mouse ENSMUSG00000036850
Gene ID - Rat ENSRNOG00000029875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL41 pAb (ATL-HPA027160)
Datasheet Anti MRPL41 pAb (ATL-HPA027160) Datasheet (External Link)
Vendor Page Anti MRPL41 pAb (ATL-HPA027160) at Atlas Antibodies

Documents & Links for Anti MRPL41 pAb (ATL-HPA027160)
Datasheet Anti MRPL41 pAb (ATL-HPA027160) Datasheet (External Link)
Vendor Page Anti MRPL41 pAb (ATL-HPA027160)