Anti MRPL18 pAb (ATL-HPA028774 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028774-25

Protein Description: mitochondrial ribosomal protein L18
Gene Name: MRPL18
Alternative Gene Name: HSPC071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057388: 77%, ENSRNOG00000014582: 75%
Entrez Gene ID: 29074
Uniprot ID: Q9H0U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA
• Gene Sequence: MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA
• Gene ID - Mouse: ENSMUSG00000057388
• Gene ID - Rat: ENSRNOG00000014582
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MRPL18 pAb (ATL-HPA028774 w/enhanced validation) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Zhang, Xingqian; Gao, Xiangwei; Coots, Ryan Alex; Conn, Crystal S; Liu, Botao; Qian, Shu-Bing. Translational control of the cytosolic stress response by mitochondrial ribosomal protein L18. Nature Structural & Molecular Biology. 2015;22(5):404-10.