Anti MRPL10 pAb (ATL-HPA021234 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021234-25

Protein Description: mitochondrial ribosomal protein L10
Gene Name: MRPL10
Alternative Gene Name: L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001445: 88%, ENSRNOG00000009567: 91%
Entrez Gene ID: 124995
Uniprot ID: Q7Z7H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC
• Gene Sequence: NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC
• Gene ID - Mouse: ENSMUSG00000001445
• Gene ID - Rat: ENSRNOG00000009567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MRPL10 pAb (ATL-HPA021234 w/enhanced validation) – 2 Found

Nouws, Jessica; Goswami, Arvind V; Bestwick, Megan; McCann, Beverly Jo; Surovtseva, Yulia V; Shadel, Gerald S. Mitochondrial Ribosomal Protein L12 Is Required for POLRMT Stability and Exists as Two Forms Generated by Alternative Proteolysis during Import. The Journal Of Biological Chemistry. 2016;291(2):989-97. 

Li, Hai-Bo; Wang, Ruo-Xi; Jiang, Hai-Bo; Zhang, En-Dong; Tan, Jie-Qiong; Xu, Hui-Zhuo; Zhou, Rong-Rong; Xia, Xiao-Bo. Mitochondrial Ribosomal Protein L10 Associates with Cyclin B1/Cdk1 Activity and Mitochondrial Function. Dna And Cell Biology. 2016;35(11):680-690.