Anti MPV17L pAb (ATL-HPA041180)

Atlas Antibodies

Catalog No.: ATL-HPA041180-25

Protein Description: MPV17 mitochondrial membrane protein-like
Gene Name: MPV17L
Alternative Gene Name: FLJ39599, MLPH1, MLPH2, MPV17L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022679: 50%, ENSRNOG00000003285: 40%
Entrez Gene ID: 255027
Uniprot ID: Q2QL34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQQSGDGTFKSAFTILYTKGTSATEGYPKK
• Gene Sequence: SQQSGDGTFKSAFTILYTKGTSATEGYPKK
• Gene ID - Mouse: ENSMUSG00000022679
• Gene ID - Rat: ENSRNOG00000003285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPV17L pAb (ATL-HPA041180) – 1 Found

Iida, Reiko; Ueki, Misuzu; Yasuda, Toshihiro. Knockout of Mpv17-Like Protein (M-LPH) Gene in Human Hepatoma Cells Results in Impairment of mtDNA Integrity through Reduction of TFAM, OGG1, and LIG3 at the Protein Levels. Oxidative Medicine And Cellular Longevity. 2018( 30310528):6956414.