Anti MPP5 pAb (ATL-HPA000993 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000993-25

Protein Description: membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
Gene Name: MPP5
Alternative Gene Name: FLJ12615, PALS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021112: 93%, ENSRNOG00000008788: 95%
Entrez Gene ID: 64398
Uniprot ID: Q8N3R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTAL
• Gene Sequence: EDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTAL
• Gene ID - Mouse: ENSMUSG00000021112
• Gene ID - Rat: ENSRNOG00000008788
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPP5 pAb (ATL-HPA000993 w/enhanced validation) – 2 Found

Brinkmann, Benjamin F; Steinbacher, Tim; Hartmann, Christian; Kummer, Daniel; Pajonczyk, Denise; Mirzapourshafiyi, Fatemeh; Nakayama, Masanori; Weide, Thomas; Gerke, Volker; Ebnet, Klaus. VE-cadherin interacts with cell polarity protein Pals1 to regulate vascular lumen formation. Molecular Biology Of The Cell. 2016;27(18):2811-21. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.