Anti MPP3 pAb (ATL-HPA024742 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024742-100

Protein Description: membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3)
Gene Name: MPP3
Alternative Gene Name: DLG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052373: 89%, ENSRNOG00000033653: 89%
Entrez Gene ID: 4356
Uniprot ID: Q13368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGL
• Gene Sequence: SQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGL
• Gene ID - Mouse: ENSMUSG00000052373
• Gene ID - Rat: ENSRNOG00000033653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.