Anti MPHOSPH9 pAb (ATL-HPA037485)

Atlas Antibodies

Catalog No.: ATL-HPA037485-25

Protein Description: M-phase phosphoprotein 9
Gene Name: MPHOSPH9
Alternative Gene Name: MPP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038126: 56%, ENSRNOG00000001074: 64%
Entrez Gene ID: 10198
Uniprot ID: Q99550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPK
• Gene Sequence: YKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPK
• Gene ID - Mouse: ENSMUSG00000038126
• Gene ID - Rat: ENSRNOG00000001074
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPHOSPH9 pAb (ATL-HPA037485) – 2 Found

Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35. 

Huang, Ning; Zhang, Donghui; Li, Fangyuan; Chai, Peiyuan; Wang, Song; Teng, Junlin; Chen, Jianguo. M-Phase Phosphoprotein 9 regulates ciliogenesis by modulating CP110-CEP97 complex localization at the mother centriole. Nature Communications. 2018;9(1):4511.