Anti MORF4L1 pAb (ATL-HPA042360)

Atlas Antibodies

Catalog No.: ATL-HPA042360-25

Protein Description: mortality factor 4 like 1
Gene Name: MORF4L1
Alternative Gene Name: Eaf3, HsT17725, MEAF3, MORFRG15, MRG15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062270: 100%, ENSRNOG00000058412: 99%
Entrez Gene ID: 10933
Uniprot ID: Q9UBU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ
• Gene Sequence: DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ
• Gene ID - Mouse: ENSMUSG00000062270
• Gene ID - Rat: ENSRNOG00000058412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MORF4L1 pAb (ATL-HPA042360) – 1 Found

Sang, Yi; Zhang, Ruhua; Sun, Longhua; Chen, Kaddie Kwok; Li, Si-Wei; Xiong, Longxin; Peng, Yongjian; Zeng, Lei; Huang, Guofu. MORF4L1 suppresses cell proliferation, migration and invasion by increasing p21 and E-cadherin expression in nasopharyngeal carcinoma. Oncology Letters. 2019;17(1):294-302.