Anti MORF4L1 pAb (ATL-HPA042360)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042360-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MORF4L1
Alternative Gene Name: Eaf3, HsT17725, MEAF3, MORFRG15, MRG15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062270: 100%, ENSRNOG00000058412: 99%
Entrez Gene ID: 10933
Uniprot ID: Q9UBU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ |
| Gene Sequence | DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ |
| Gene ID - Mouse | ENSMUSG00000062270 |
| Gene ID - Rat | ENSRNOG00000058412 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MORF4L1 pAb (ATL-HPA042360) | |
| Datasheet | Anti MORF4L1 pAb (ATL-HPA042360) Datasheet (External Link) |
| Vendor Page | Anti MORF4L1 pAb (ATL-HPA042360) at Atlas Antibodies |
| Documents & Links for Anti MORF4L1 pAb (ATL-HPA042360) | |
| Datasheet | Anti MORF4L1 pAb (ATL-HPA042360) Datasheet (External Link) |
| Vendor Page | Anti MORF4L1 pAb (ATL-HPA042360) |
| Citations for Anti MORF4L1 pAb (ATL-HPA042360) – 1 Found |
| Sang, Yi; Zhang, Ruhua; Sun, Longhua; Chen, Kaddie Kwok; Li, Si-Wei; Xiong, Longxin; Peng, Yongjian; Zeng, Lei; Huang, Guofu. MORF4L1 suppresses cell proliferation, migration and invasion by increasing p21 and E-cadherin expression in nasopharyngeal carcinoma. Oncology Letters. 2019;17(1):294-302. PubMed |