Anti MOCS3 pAb (ATL-HPA027556)

Atlas Antibodies

Catalog No.: ATL-HPA027556-25

Protein Description: molybdenum cofactor synthesis 3
Gene Name: MOCS3
Alternative Gene Name: dJ914P20.3, UBA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074576: 72%, ENSRNOG00000025067: 73%
Entrez Gene ID: 27304
Uniprot ID: O95396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQDEILRSSRQLVLPELGVHRHVLVVGCGGLRCPLAQYLAAASVGRLGLVDYDVVEMSNLAYQVLHGEALAAQAKAASAAASLRGLNLAVE
• Gene Sequence: FQDEILRSSRQLVLPELGVHRHVLVVGCGGLRCPLAQYLAAASVGRLGLVDYDVVEMSNLAYQVLHGEALAAQAKAASAAASLRGLNLAVE
• Gene ID - Mouse: ENSMUSG00000074576
• Gene ID - Rat: ENSRNOG00000025067
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.