Anti MOCOS pAb (ATL-HPA039412)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039412-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MOCOS
Alternative Gene Name: FLJ20733, HMCS, MOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039616: 84%, ENSRNOG00000015113: 84%
Entrez Gene ID: 55034
Uniprot ID: Q96EN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLAGEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVA |
| Gene Sequence | VSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLAGEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVA |
| Gene ID - Mouse | ENSMUSG00000039616 |
| Gene ID - Rat | ENSRNOG00000015113 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MOCOS pAb (ATL-HPA039412) | |
| Datasheet | Anti MOCOS pAb (ATL-HPA039412) Datasheet (External Link) |
| Vendor Page | Anti MOCOS pAb (ATL-HPA039412) at Atlas Antibodies |
| Documents & Links for Anti MOCOS pAb (ATL-HPA039412) | |
| Datasheet | Anti MOCOS pAb (ATL-HPA039412) Datasheet (External Link) |
| Vendor Page | Anti MOCOS pAb (ATL-HPA039412) |