Anti MOB4 pAb (ATL-HPA044125)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044125-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MOB4
Alternative Gene Name: 2C4D, CGI-95, DKFZP564M112, MOB3, MOBKL3, PHOCN, PREI3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025979: 100%, ENSRNOG00000014980: 100%
Entrez Gene ID: 25843
Uniprot ID: Q9Y3A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKES |
| Gene Sequence | RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKES |
| Gene ID - Mouse | ENSMUSG00000025979 |
| Gene ID - Rat | ENSRNOG00000014980 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MOB4 pAb (ATL-HPA044125) | |
| Datasheet | Anti MOB4 pAb (ATL-HPA044125) Datasheet (External Link) |
| Vendor Page | Anti MOB4 pAb (ATL-HPA044125) at Atlas Antibodies |
| Documents & Links for Anti MOB4 pAb (ATL-HPA044125) | |
| Datasheet | Anti MOB4 pAb (ATL-HPA044125) Datasheet (External Link) |
| Vendor Page | Anti MOB4 pAb (ATL-HPA044125) |
| Citations for Anti MOB4 pAb (ATL-HPA044125) – 1 Found |
| Berger, Joachim; Berger, Silke; Currie, Peter D. Mob4-dependent STRIPAK involves the chaperonin TRiC to coordinate myofibril and microtubule network growth. Plos Genetics. 2022;18(6):e1010287. PubMed |