Anti MOB4 pAb (ATL-HPA044125)

Atlas Antibodies

Catalog No.:
ATL-HPA044125-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MOB family member 4, phocein
Gene Name: MOB4
Alternative Gene Name: 2C4D, CGI-95, DKFZP564M112, MOB3, MOBKL3, PHOCN, PREI3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025979: 100%, ENSRNOG00000014980: 100%
Entrez Gene ID: 25843
Uniprot ID: Q9Y3A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKES
Gene Sequence RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKES
Gene ID - Mouse ENSMUSG00000025979
Gene ID - Rat ENSRNOG00000014980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MOB4 pAb (ATL-HPA044125)
Datasheet Anti MOB4 pAb (ATL-HPA044125) Datasheet (External Link)
Vendor Page Anti MOB4 pAb (ATL-HPA044125) at Atlas Antibodies

Documents & Links for Anti MOB4 pAb (ATL-HPA044125)
Datasheet Anti MOB4 pAb (ATL-HPA044125) Datasheet (External Link)
Vendor Page Anti MOB4 pAb (ATL-HPA044125)
Citations for Anti MOB4 pAb (ATL-HPA044125) – 1 Found
Berger, Joachim; Berger, Silke; Currie, Peter D. Mob4-dependent STRIPAK involves the chaperonin TRiC to coordinate myofibril and microtubule network growth. Plos Genetics. 2022;18(6):e1010287.  PubMed