Anti MMP16 pAb (ATL-HPA023693)

Atlas Antibodies

Catalog No.: ATL-HPA023693-25

Protein Description: matrix metallopeptidase 16 (membrane-inserted)
Gene Name: MMP16
Alternative Gene Name: C8orf57, DKFZp761D112, MT3-MMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028226: 98%, ENSRNOG00000005708: 98%
Entrez Gene ID: 4325
Uniprot ID: P51512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD
• Gene Sequence: TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD
• Gene ID - Mouse: ENSMUSG00000028226
• Gene ID - Rat: ENSRNOG00000005708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MMP16 pAb (ATL-HPA023693) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.