Anti MMP16 pAb (ATL-HPA023693)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023693-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MMP16
Alternative Gene Name: C8orf57, DKFZp761D112, MT3-MMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028226: 98%, ENSRNOG00000005708: 98%
Entrez Gene ID: 4325
Uniprot ID: P51512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD |
| Gene Sequence | TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD |
| Gene ID - Mouse | ENSMUSG00000028226 |
| Gene ID - Rat | ENSRNOG00000005708 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MMP16 pAb (ATL-HPA023693) | |
| Datasheet | Anti MMP16 pAb (ATL-HPA023693) Datasheet (External Link) |
| Vendor Page | Anti MMP16 pAb (ATL-HPA023693) at Atlas Antibodies |
| Documents & Links for Anti MMP16 pAb (ATL-HPA023693) | |
| Datasheet | Anti MMP16 pAb (ATL-HPA023693) Datasheet (External Link) |
| Vendor Page | Anti MMP16 pAb (ATL-HPA023693) |
| Citations for Anti MMP16 pAb (ATL-HPA023693) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |