Anti MMP1 pAb (ATL-HPA004920)

Atlas Antibodies

Catalog No.: ATL-HPA004920-25

Protein Description: matrix metallopeptidase 1
Gene Name: MMP1
Alternative Gene Name: CLG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041620: 55%, ENSRNOG00000032353: 53%
Entrez Gene ID: 4312
Uniprot ID: P03956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDH
• Gene Sequence: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDH
• Gene ID - Mouse: ENSMUSG00000041620
• Gene ID - Rat: ENSRNOG00000032353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MMP1 pAb (ATL-HPA004920) – 1 Found

Fredolini, Claudia; Byström, Sanna; Sanchez-Rivera, Laura; Ioannou, Marina; Tamburro, Davide; Pontén, Fredrik; Branca, Rui M; Nilsson, Peter; Lehtiö, Janne; Schwenk, Jochen M. Systematic assessment of antibody selectivity in plasma based on a resource of enrichment profiles. Scientific Reports. 2019;9(1):8324.