Anti MMAB pAb (ATL-HPA039017 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039017-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MMAB
Alternative Gene Name: cblB, CFAP23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029575: 84%, ENSRNOG00000049426: 84%
Entrez Gene ID: 326625
Uniprot ID: Q96EY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL |
| Gene Sequence | AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL |
| Gene ID - Mouse | ENSMUSG00000029575 |
| Gene ID - Rat | ENSRNOG00000049426 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) | |
| Datasheet | Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) | |
| Datasheet | Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) |
| Citations for Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) – 1 Found |
| Forny, Patrick; Bonilla, Ximena; Lamparter, David; Shao, Wenguang; Plessl, Tanja; Frei, Caroline; Bingisser, Anna; Goetze, Sandra; van Drogen, Audrey; Harshman, Keith; Pedrioli, Patrick G A; Howald, Cedric; Poms, Martin; Traversi, Florian; Bürer, Céline; Cherkaoui, Sarah; Morscher, Raphael J; Simmons, Luke; Forny, Merima; Xenarios, Ioannis; Aebersold, Ruedi; Zamboni, Nicola; Rätsch, Gunnar; Dermitzakis, Emmanouil T; Wollscheid, Bernd; Baumgartner, Matthias R; Froese, D Sean. Integrated multi-omics reveals anaplerotic rewiring in methylmalonyl-CoA mutase deficiency. Nature Metabolism. 2023;5(1):80-95. PubMed |