Anti MMAB pAb (ATL-HPA039017 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039017-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: methylmalonic aciduria (cobalamin deficiency) cblB type
Gene Name: MMAB
Alternative Gene Name: cblB, CFAP23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029575: 84%, ENSRNOG00000049426: 84%
Entrez Gene ID: 326625
Uniprot ID: Q96EY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
Gene Sequence AFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
Gene ID - Mouse ENSMUSG00000029575
Gene ID - Rat ENSRNOG00000049426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MMAB pAb (ATL-HPA039017 w/enhanced validation)
Datasheet Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MMAB pAb (ATL-HPA039017 w/enhanced validation)
Datasheet Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MMAB pAb (ATL-HPA039017 w/enhanced validation)
Citations for Anti MMAB pAb (ATL-HPA039017 w/enhanced validation) – 1 Found
Forny, Patrick; Bonilla, Ximena; Lamparter, David; Shao, Wenguang; Plessl, Tanja; Frei, Caroline; Bingisser, Anna; Goetze, Sandra; van Drogen, Audrey; Harshman, Keith; Pedrioli, Patrick G A; Howald, Cedric; Poms, Martin; Traversi, Florian; Bürer, Céline; Cherkaoui, Sarah; Morscher, Raphael J; Simmons, Luke; Forny, Merima; Xenarios, Ioannis; Aebersold, Ruedi; Zamboni, Nicola; Rätsch, Gunnar; Dermitzakis, Emmanouil T; Wollscheid, Bernd; Baumgartner, Matthias R; Froese, D Sean. Integrated multi-omics reveals anaplerotic rewiring in methylmalonyl-CoA mutase deficiency. Nature Metabolism. 2023;5(1):80-95.  PubMed