Anti MLLT11 pAb (ATL-HPA000540)

Atlas Antibodies

Catalog No.:
ATL-HPA000540-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11
Gene Name: MLLT11
Alternative Gene Name: AF1Q
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053192: 83%, ENSRNOG00000021110: 79%
Entrez Gene ID: 10962
Uniprot ID: Q13015
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL
Gene Sequence FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL
Gene ID - Mouse ENSMUSG00000053192
Gene ID - Rat ENSRNOG00000021110
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MLLT11 pAb (ATL-HPA000540)
Datasheet Anti MLLT11 pAb (ATL-HPA000540) Datasheet (External Link)
Vendor Page Anti MLLT11 pAb (ATL-HPA000540) at Atlas Antibodies

Documents & Links for Anti MLLT11 pAb (ATL-HPA000540)
Datasheet Anti MLLT11 pAb (ATL-HPA000540) Datasheet (External Link)
Vendor Page Anti MLLT11 pAb (ATL-HPA000540)