Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010811-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MLF2
Alternative Gene Name: NTN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030120: 95%, ENSRNOG00000016589: 95%
Entrez Gene ID: 8079
Uniprot ID: Q15773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQA |
| Gene Sequence | MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQA |
| Gene ID - Mouse | ENSMUSG00000030120 |
| Gene ID - Rat | ENSRNOG00000016589 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation) | |
| Datasheet | Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation) | |
| Datasheet | Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation) |
| Citations for Anti MLF2 pAb (ATL-HPA010811 w/enhanced validation) – 1 Found |
| Schludi, Martin H; Becker, Lore; Garrett, Lillian; Gendron, Tania F; Zhou, Qihui; Schreiber, Franziska; Popper, Bastian; Dimou, Leda; Strom, Tim M; Winkelmann, Juliane; von Thaden, Anne; Rentzsch, Kristin; May, Stephanie; Michaelsen, Meike; Schwenk, Benjamin M; Tan, Jing; Schoser, Benedikt; Dieterich, Marianne; Petrucelli, Leonard; Hölter, Sabine M; Wurst, Wolfgang; Fuchs, Helmut; Gailus-Durner, Valerie; de Angelis, Martin Hrabe; Klopstock, Thomas; Arzberger, Thomas; Edbauer, Dieter. Spinal poly-GA inclusions in a C9orf72 mouse model trigger motor deficits and inflammation without neuron loss. Acta Neuropathologica. 2017;134(2):241-254. PubMed |