Anti MKS1 pAb (ATL-HPA021812 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021812-25

Protein Description: Meckel syndrome, type 1
Gene Name: MKS1
Alternative Gene Name: BBS13, FLJ20345, MKS, POC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034121: 87%, ENSRNOG00000008635: 85%
Entrez Gene ID: 54903
Uniprot ID: Q9NXB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA
• Gene Sequence: TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA
• Gene ID - Mouse: ENSMUSG00000034121
• Gene ID - Rat: ENSRNOG00000008635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MKS1 pAb (ATL-HPA021812 w/enhanced validation) – 1 Found

Mahuzier, Alexia; Gaudé, Helori-Mael; Grampa, Valentina; Anselme, Isabelle; Silbermann, Flora; Leroux-Berger, Margot; Delacour, Delphine; Ezan, Jerome; Montcouquiol, Mireille; Saunier, Sophie; Schneider-Maunoury, Sylvie; Vesque, Christine. Dishevelled stabilization by the ciliopathy protein Rpgrip1l is essential for planar cell polarity. The Journal Of Cell Biology. 2012;198(5):927-40.